Differnce Between A Humanized Monoclonal Antibody And Monoclonal Antibodies
Anti-Myc and Anti-DDK monoclonal antibodies |
|||
TA150014 | Origene Technologies GmbH | 2 tubes @ 50 ul each | Ask for price |
Human Antibody Laboratories manufactures the differnce between a humanized monoclonal antibody and monoclonal antibodies reagents distributed by Genprice. The Differnce Between A Humanized Monoclonal Antibody And Monoclonal Antibodies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Differnce products are available in stock. Specificity: Differnce Category: Between Group: A Humanized
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 471.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 564 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC041520-500 | Biotium | 500uL | EUR 652.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405S conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC401520-100 | Biotium | 100uL | EUR 238.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF640R conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC401520-500 | Biotium | 500uL | EUR 652.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF640R conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCAP1520-100 | Biotium | 100uL | EUR 238.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCAP1520-500 | Biotium | 500uL | EUR 652.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCA1520-250 | Biotium | 250uL | EUR 459.6 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),APC conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCR1520-250 | Biotium | 250uL | EUR 459.6 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),RPE conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCH1520-100 | Biotium | 100uL | EUR 238.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCH1520-500 | Biotium | 500uL | EUR 652.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCP1520-250 | Biotium | 250uL | EUR 459.6 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),PerCP conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCB1520-100 | Biotium | 100uL | EUR 238.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Biotin conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCB1520-500 | Biotium | 500uL | EUR 652.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Biotin conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNUB1520-100 | Biotium | 100uL | EUR 250.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNUB1520-500 | Biotium | 500uL | EUR 549.6 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNUM1520-50 | Biotium | 50uL | EUR 474 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC471520-100 | Biotium | 100uL | EUR 238.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF647 conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC471520-500 | Biotium | 500uL | EUR 652.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF647 conjugate, Concentration: 0.1mg/mL |