96372 Or 96401 For Human Monoclonal Antibody

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Antibody Laboratories manufactures the 96372 or 96401 for human monoclonal antibody reagents distributed by Genprice. The 96372 Or 96401 For Human Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other 96372 products are available in stock. Specificity: 96372 Category: Or Group: 96401 For

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594.

96401 For information

Monoclonal antibody for Tau

SMC-607D-RPE 0.1mg
EUR 541.2
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with RPE.

Monoclonal antibody for Tau

SMC-607D-STR 0.1mg
EUR 542.4
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Streptavidin.

Monoclonal antibody for Tau

SMC-607S 0.012mg
EUR 78
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is not conjugated.

Monoclonal antibody for Tau

SMC-608D 0.1mg
EUR 489.6
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is not conjugated.

Monoclonal antibody for Tau

SMC-608D-A390 0.1mg
EUR 546
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 390.

Monoclonal antibody for Tau

SMC-608D-A488 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 488.

Monoclonal antibody for Tau

SMC-608D-A565 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 565.

Monoclonal antibody for Tau

SMC-608D-A594 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 594.

Monoclonal antibody for Tau

SMC-608D-A633 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 633.

Monoclonal antibody for Tau

SMC-608D-A655 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 655.

Monoclonal antibody for Tau

SMC-608D-A680 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 680.

Monoclonal antibody for Tau

SMC-608D-A700 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 700.

Monoclonal antibody for Tau

SMC-608D-ALP 0.1mg
EUR 537.6
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Alkaline Phosphatase.

Monoclonal antibody for Tau

SMC-608D-APC 0.1mg
EUR 543.6
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with APC.

Monoclonal antibody for Tau

SMC-608D-APCCY7 0.1mg
EUR 630
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with APC/Cy7.

Monoclonal antibody for Tau

SMC-608D-BI 0.1mg
EUR 540
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Biotin.

Monoclonal antibody for Tau

SMC-608D-DY350 0.1mg
EUR 561.6
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Dylight 350.