Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Ige Monoclonal Laboratories manufactures the ige monoclonal ab for asthma reagents distributed by Genprice. The Ige Monoclonal Ab For Asthma reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Ige products are available in stock. Specificity: Ige Category: Monoclonal Group: Ab For
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 477.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 564 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 474 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 495.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 482.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 470.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 472.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594. |
Ab For information
CNX | Calnexin (monoclonal, clone 11A1) |
|
AS17-4164 |
Agrisera AB |
1 ml |
EUR 302 |
Aflatoxin B1 (monoclonal, clone 3b12) |
|
AS22-4760 |
Agrisera AB |
100 µg |
EUR 378 |
Asthma relating compound 1 |
|
MBS5766156-5mg |
MyBiosource |
5mg |
EUR 915 |
Asthma relating compound 1 |
|
MBS5766156-5x5mg |
MyBiosource |
5x5mg |
EUR 3970 |
Asthma relating compound 1 |
|
T10508-1mg |
TargetMol Chemicals |
1mg |
Ask for price |
|
|
|
Description: Asthma relating compound 1 |
Asthma relating compound 1 |
|
T10508-50mg |
TargetMol Chemicals |
50mg |
Ask for price |
|
|
|
Description: Asthma relating compound 1 |
Asthma relating compound 1 |
|
T10508-5mg |
TargetMol Chemicals |
5mg |
Ask for price |
|
|
|
Description: Asthma relating compound 1 |
Asthma relating compound 1 |
|
T10508-10mg |
TargetMol Chemicals |
10mg |
Ask for price |
|
|
|
Description: Asthma relating compound 1 |
Asthma relating compound 1 |
|
T10508-1g |
TargetMol Chemicals |
1g |
Ask for price |
|
|
|
Description: Asthma relating compound 1 |
Glucuronoxylan (monoclonal, clone LM28) |
|
AS18-4208-1ml |
Agrisera AB |
1 ml |
EUR 246 |
GST-tag clone 21, mouse monoclonal |
|
AS20-4514 |
Agrisera AB |
100 µg |
EUR 233 |
ZEA | Zearalenone (monoclonal, clone 11C9) |
|
AS22-4756 |
Agrisera AB |
100 µg |
EUR 378 |
His-tag | 6xHis (monoclonal, Clone 2C5,1) |
|
AS20-4457 |
Agrisera AB |
100 µg |
EUR 367 |
Acetylated Lysine (monoclonal, clone 7F8) |
|
AS10-707-100 |
Agrisera AB |
100 µl |
EUR 439 |
Tubulin beta chain (monoclonal antibody) |
|
AS20-4484 |
Agrisera AB |
100 µg |
EUR 259 |
MBP | Maltose Binding Protein (monoclonal) |
|
AS21-4678 |
Agrisera AB |
50 µg |
EUR 155 |
