Ige Monoclonal Ab For Asthma

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Ige Monoclonal Laboratories manufactures the ige monoclonal ab for asthma reagents distributed by Genprice. The Ige Monoclonal Ab For Asthma reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Ige products are available in stock. Specificity: Ige Category: Monoclonal Group: Ab For

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594.

Ab For information

Mouse Anti Dog Ige Monoclonal Antibody,Biotin

DMABT-48837MD 0.25 mg
EUR 1070.4

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), PE

4-MAA545Po21-PE
  • EUR 384.00
  • EUR 3582.00
  • EUR 1003.20
  • EUR 487.20
  • EUR 246.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with PE.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), HRP

4-MAA545Po21-HRP
  • EUR 410.40
  • EUR 3874.80
  • EUR 1081.20
  • EUR 522.00
  • EUR 261.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with HRP.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), APC

4-MAA545Po21-APC
  • EUR 450.00
  • EUR 4448.40
  • EUR 1224.00
  • EUR 579.60
  • EUR 278.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with APC.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), Cy3

4-MAA545Po21-Cy3
  • EUR 550.80
  • EUR 5881.20
  • EUR 1582.80
  • EUR 722.40
  • EUR 321.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with Cy3.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), FITC

4-MAA545Po21-FITC
  • EUR 384.00
  • EUR 3582.00
  • EUR 1003.20
  • EUR 487.20
  • EUR 246.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with FITC.

Anti-Human IgE, Rabbit Monoclonal Antibody

A1800-50 each
EUR 392.4

Rabbit Anti Human IGF2 Monoclonal Clone IGE-9

IRBAHUIGF2IGE9C100UL each
EUR 496
Description: Rabbit Anti Human IGF2 Monoclonal Clone IGE-9

Mouse Anti Horse IgE Monoclonal Clone 3A1 Lyophilized

IMSAHSIGE3A1C500UG each
EUR 1147
Description: Mouse Anti Horse IgE Monoclonal Clone 3A1 Lyophilized

Mouse Anti Horse IgE Monoclonal Clone 3E6 Lyophilized

IMSAHSIGE3E6C500UG each
EUR 1147
Description: Mouse Anti Horse IgE Monoclonal Clone 3E6 Lyophilized

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), Biotinylated

4-MAA545Po21-Biotin
  • EUR 399.60
  • EUR 3331.20
  • EUR 967.20
  • EUR 494.40
  • EUR 273.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with Biotin.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), APC-Cy7

4-MAA545Po21-APC-Cy7
  • EUR 757.20
  • EUR 8752.80
  • EUR 2305.20
  • EUR 1015.20
  • EUR 412.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with APC-Cy7.

Mouse Monoclonal Anti-Cat IgE-HRP conjugate

71050-HP 0.5 ml
EUR 343.2

Mouse Anti Human IgE Monoclonal Clone 24A HRP Labeled

IMSAHUIGE24ACHRP1MG each
EUR 428
Description: Mouse Anti Human IgE Monoclonal Clone 24A HRP Labeled

Monoclonal Anti-Human IgE (clone 1), aff pure

IGEH11-M 100 ug
EUR 578.4

Monoclonal Anti-Human IgE (clone 2), aff pure

IGEH12-M 100 ug
EUR 578.4

Monoclonal Anti-Human IgE (clone 3), aff pure

IGEH13-M 100 ug
EUR 578.4